Katson geeneistä PREP ja PREPL jotain niiden vaikutuksista.

Tämä on vasta bulk-alkuhakua. Katson ajan mittaan vähän vähemmäksi tämän artikkelin  sisällön. Kyse on prolyyliä pilkkova entsyymi. se pilkkoo oligopeptidin C_terminaalista. PREPL ei pilko   arginiinin tai lysiinin jälkeen (R tai K)  ja se on muutenkin  erilainen hieman rakennepiirteiltään, kuten esim  sisältää runsaasti  cysteinejä (C) ihan  riittäisi sinkkisormeksikin ja rakenne on miltei  puolipropellinen.  Toimivatkohan nuo peräkanaa?

 

(*) TÄSTÄ KIRJOITTAA DUODECIM  11/23

Katson GENECARDS lähteestä : “PREP” ja sen jälkeen PREP

Tekstit mainitsevat että se jollain tavalla osallistuu inositolin aineenvaihduntaan, joten katson tarkemmin. Lisäksi se puuttuu QPPAQP etc. sisältävien peptidien pilkkoutumiseen. Joita uodostuss gluteenipitoisesta ravinnosta. Huomaan että se on selektiivisesstio peptidien C-terminaalisen proliinin pilkkoja ja tuotaa oligopeptidilopputuotteita eikä esim. erillisiä proliineja tai erillisiäaminohappoja. Sen rakenteessa ei näy tavallisia Znf sinkkisormimahdollisuuksia. Se on aika järjestäytynyt beetanauhojensa ja alfahelixiensä suhteen.Se ei vaikuta suoraan sigannlivälittäjään IP3 itse vaan sen kinaasisäätelyjärjestelmään, joka on saateaa olla laaja. Siitä tietoisuus on kasvanut nyt vuosituhannen vaihteen jälkeen.

* HAKU GENE CARDS “PREP Showing 25 of 2,755 results for PREP Search Time: 0 ms.

PREP (6q21).  Prolyl oligoendopeptidases                    GENECARDS haku 12.6. 2023 .

Aliases for PREP Gene

• GeneCards Symbol: PREP 2

• Prolyl Endopeptidase 2 3 4 5

• Post-Proline Cleaving Enzyme 3 4

• Prolyl Oligopeptidase 2 3

• EC 3.4.21.26 4 48

• PEP 3 4

• PE 3 4

• DJ355L5.1 (Prolyl Endopeptidase) 3

The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. [provided by RefSeq, Jul 2008]

GeneCards Summary for PREP Gene: PREP (Prolyl Endopeptidase) is a Protein Coding gene. Diseases associated with PREP include Amnestic Disorder and Post-Traumatic Stress Disorder. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase activity and serine-type exopeptidase activity. An important paralog of this gene is PREPL. 

  UniProtKB/Swiss-Prot Summary for PREP Gene: Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. ( PPCE_HUMAN,P48147 )

Show:

		Symbol	Description	Category	UniProt ID	GIFtS	GC id	Score ▼
1		PREP	Prolyl Endopeptidase	Protein Coding	P48147	49	GC06M105277	43.35
Header Symbol: PREP Publications (5/19) See All Prolyl oligopeptidase enhances α-synuclein...protein-protein interaction. (PMID: 25555914) Abstract: ...oligopeptidase (PREP) accelerates the aggregation of α-synuclein (aSyn)...of Parkinson disease and other synucleinopathies. PREP inhibitors reduce aSyn aggregation, but the mechanism...microscale thermophoresis in parallel to show that PREP interacts directly with aSyn in both intact cells...split luciferase-based PCA, we first showed that PREP enhances the formation of soluble aSyn dimers in live Neuro-2A neuroblastoma cells. A PREP inhibitor, KYP-2047, reduced aSyn dimerization in PREP-expressing cells but not in cells lacking PREP expression. aSyn dimerization was also enhanced by PREP(S554A), an enzymatically inactive PREP mutant, but this was not affected by KYP-2047. PCA...thermophoresis studies showed that aSyn interacts with both PREP and PREP... Prolyl oligopeptidase inhibition reduces...phosphatase 2A. (PMID: 33838285) Abstract: ...oligopeptidase (PREP) is a serine protease that is linked to neurodegeneration, as endogenous PREP inhibits autophagy and induces the accumulation of...detrimental protein aggregates. As such, inhibition of PREP by a small-molecular inhibitor has provided neuroprotection...models of neurodegenerative diseases. In addition, PREP inhibition has been shown to reduce production of...reactive oxygen species (ROS) and the absence of PREP blocks stress-induced ROS production. However, the mechanism behind PREP-related ROS regulation is not known. As we recently discovered PREP's physiological role as a protein phosphatase 2A (PP2A) regulator, we wanted to characterize PREP inhibition as an approach to reduce OS. We studied the impact of a PREP inhibitor, KYP-2047, on hydrogen peroxide and ferrous...and SH-SY5Y cells. In addition, we used HEK-2... Distribution of prolyl oligopeptidase in...colorectal tumors. (PMID: 22740343) Abstract: ...oligopeptidase (PREP) is a serine protease that hydrolyzes peptides shorter...multiple physiological and pathological conditions. PREP has been mostly studied in the brain, but significant PREP activities have been measured in peripheral tissues. Moreover, increased PREP activities have been found in tumors. In this study...authors studied the immunohistochemical distribution of PREP protein in human peripheral tissues and in ovarian and colorectal tumors. PREP was found to be widely distributed in human peripheral...and specifically in certain cells. The most intense PREP expression was seen in the testis, ovaries, liver...some parts of the skin. At the cellular level, high PREP levels were seen as a rule in secreting epithelial...cells and cells involved in reproduction. Increased PREP expression was seen in most of the tumors studied. PREP expression was high... (x) Prolyl oligopeptidase inhibition activates...phosphatase 2A. (PMID: 31759088) Abstract: Prolyl endopeptidase is involved in cellular...SH-SY5Y cells. (PMID: 21487212) Abstract: Prolyl endopeptidase (PREP), probably acting through the inositol cycle, has been implicated in memory and learning. However, the physiological role of PREP is unknown. It has been shown that PREP expression, regulated in cerebellar granule cells...report the levels and subcellular distribution of PREP in human neuroblastoma SH-SY5Y cells in proliferating conditions and under differentiation induced by retinoic acid (RA). We analysed the levels of cell signalling intermediates, growth behavior and gene expression, and differentiation morphology changes, upon PREP inhibition. After induction of differentiation,PREP activity was found decreased in the nucleus but increased to high levels in the cytoplasm, due in part to increased PREP transcription. The levels of inositol (1,4,5)-trisphosphate revealed no correlation with PREP activity, but phosphorylated extracellular signal-regulated kinases 1 and 2 were decreased by PREP inhibition during early stages of differentiation. Morphological evaluation indicated that PREP inhibition retarded the onset of differentiation. PREP activity regulated gene expression of protein synthesis machinery, intracellular transport and kinase complexes. We conclude that PREP is a regulatory target and a regulatory element in cell signalling. This is the first report of a direct influence of a cell signalling molecule, RA, on PREP expression. Function Phenotypes (5/10) See All homeostasis/metabolism phenotype: Alleles: Prep PrepGt(RRM213)Byg / Prep Preptm1b(KOMP)Wtsi - MP:0005376 behavior/neurological phenotype: Alleles: Prep Preptm1b(KOMP)Wtsi / Prep Preptm1Dgen - MP:0005386 renal/urinary system phenotype: Alleles: Prep PrepGt(RRM213)Byg - MP:0005367 liver/biliary system phenotype: Alleles: Prep PrepGt(RRM213)Byg - MP:0005370 adipose tissue phenotype: Alleles: Prep PrepGt(RRM213)Byg - MP:0005375

(x)  Pharmacol Res

• 2020 Jan;151:104558. doi: 10.1016/j.phrs.2019.104558. Epub 2019 Nov 20.Prolyl oligopeptidase inhibition activates autophagy via protein phosphatase 2A Reinis Svarcbahs  1 , Maria Jäntti  1 , Tommi Kilpeläinen  1 , Ulrika H Julku  1 , Lauri Urvas  1 , Saara Kivioja  1 , Susanna Norrbacka  1 , Timo T Myöhänen  DOI: 10.1016/j.phrs.2019.104558 
• Abstract. Prolyl oligopeptidase (PREP) is a serine protease that has been studied particularly in the context of neurodegenerative diseases for decades but its physiological function has remained unclear. We have previously found that PREP negatively regulates beclin1-mediated macroautophagy (autophagy), and that PREP inhibition by a small-molecule inhibitor induces clearance of protein aggregates in Parkinson's disease models. Since autophagy induction has been suggested as a potential therapy for several diseases, we wanted to further characterize how PREP regulates autophagy. We measured the levels of various kinases and proteins regulating beclin1-autophagy in HEK-293 and SH-SY5Y cell cultures after PREP inhibition, PREP deletion, and PREP overexpression and restoration, and verified the results in vivo by using PREP knock-out and wild-type mouse tissue where PREP was restored or overexpressed, respectively. We found that PREP regulates autophagy by interacting with protein phosphatase 2A (PP2A) and its endogenous inhibitor, protein phosphatase methylesterase 1 (PME1), and activator (protein phosphatase 2 phosphatase activator, PTPA), thus adjusting its activity and the levels of PP2A in the intracellular pool. PREP inhibition and deletion increased PP2A activity, leading to activation of death-associated protein kinase 1 (DAPK1), beclin1 phosphorylation and induced autophagy while PREP overexpression reduced this. Lowered activity of PP2A is connected to several neurodegenerative disorders and cancers, and PP2A activators would have enormous potential as drug therapy but development of such compounds has been a challenge. The concept of PREP inhibition has been proved safe, and therefore, our study supports the further development of PREP inhibitors as PP2A activators.Keywords: Alzheimer’s disease; Bafilomycin A1 (PubChem CID: 6436223); FTY-720 (fingolimod, PubChem CID: 107970); KYP-2047 (PubChem CID: 11198569); Neurodegeneration; Okadaic acid (PubChem CID: 446512); PP242 (PubChem CID: 135565635); Parkinson’s disease; Protein phosphatase 2 phosphatase activator; Protein phosphatase methylesterase 1; Rapamycin (sirolimus, PubChem CID: 5284616); Serine protease. Copyright © 2019 Elsevier Ltd. All rights reserved.

Similar articles

• Deletion or inhibition of prolyl oligopeptidase blocks lithium-induced phosphorylation of GSK3b and Akt by activation of protein phosphatase 2A. Myöhänen TT, Mertens F, Norrbacka S, Cui H. Basic Clin Pharmacol Toxicol. 2021 Oct;129(4):287-296. doi: 10.1111/bcpt.13632. Epub 2021 Jul 20. PMID: 34196102

  Prolyl oligopeptidase inhibition reduces oxidative stress via reducing NADPH oxidase activity by activating protein phosphatase 2A. Eteläinen T, Kulmala V, Svarcbahs R, Jäntti M, Myöhänen TT. Free Radic Biol Med. 2021 Jun;169:14-23. doi: 10.1016/j.freeradbiomed.2021.04.001. Epub 2021 Apr 7. PMID: 33838285

• The effect of prolyl oligopeptidase inhibitors on alpha-synuclein aggregation and autophagy cannot be predicted by their inhibitory efficacy. Kilpeläinen TP, Hellinen L, Vrijdag J, Yan X, Svarcbahs R, Vellonen KS, Lambeir AM, Huttunen H, Urtti A, Wallen EAA, Myöhänen TT. Biomed Pharmacother. 2020 Aug;128:110253. doi: 10.1016/j.biopha.2020.110253. Epub 2020 May 22. PMID: 32447211

• New tricks of prolyl oligopeptidase inhibitors - A common drug therapy for several neurodegenerative diseases. Svarcbahs R, Julku U, Kilpeläinen T, Kyyrö M, Jäntti M, Myöhänen TT. Biochem Pharmacol. 2019 Mar;161:113-120. doi: 10.1016/j.bcp.2019.01.013. Epub 2019 Jan 17. PMID: 30660495 Review.

• 'How can I halt thee?' The puzzles involved in autophagic inhibition. Vinod V, Padmakrishnan CJ, Vijayan B, Gopala S. Pharmacol Res. 2014 Apr;82:1-8. doi: 10.1016/j.phrs.2014.03.005. Epub 2014 Mar 21. PMID: 24657238 Review. Abstract

The strategy for interpreting the role of autophagy on the basis of evidence obtained through autophagic inhibition sounds logical, but is beset with practical constraints. The knock down of autophagy-related (ATG) gene(s) or blockage of class III PI3-Kinase are the most common approaches for inhibiting autophagy. However, during stressful conditions, autophagy may operate in synchrony with other processes such as apoptosis; autophagy-related genes, unlike what their name implies, exert their regulation on apoptosis as well. Knocking down such genes not only blocks autophagy but also renders apoptosis defective, making the interpretation of autophagic roles unreliable. Similarly, class III PI3-Kinase aids in initiating autophagy but it is not a quintessential autophagic regulator. Class III PI3-Kinase also has a role in regulating almost all membrane transport in cells. Blocking it not only inhibits autophagy, but also hampers all the membrane trades, including endosomal transport. The pharmacological inhibitors used to block autophagy by blocking class III PI3-Kinase further compound these limitations with their off-target effects. Knowing the limitations involved in blocking a target or using an autophagy-blocking tool is a prerequisite for designing the experiments meant for analyzing autophagic functions. This review attempts to provide a detailed overview about the practical constraints involved in using autophagic inhibition as a strategy to understand autophagy.Keywords: 3-Methyladenine; 3-Methyladenine (PubChem CID: 1673); Ammonium chloride (PubChem CID: 25517); Apoptosis; Atg5; Autophagy; Bafilomycin A1 (PubChem CID: 6436223); Beclin1; Chloroquine (PubChem CID: 2719); E64d (PubChem CID: 393035); KU55933 (PubChem CID: 5278396); Monensin (PubChem CID: 28263); Wortmannin (PubChem CID: 312145). Copyright © 2014 Elsevier Ltd. All rights reserved.

See all similar articles

(*) Toinen HAKU “PREPL”(2p21)

Selected DME Specific Peptides for PREP Gene

P48147:

• KQHFEWL
• LCAEFPDEPKWMGGAELSDDGRYVLLSI
• TNEGTVFTFKTNR
• VFREVTVKGIDA
• AYGLSASGSDWVTIKFMKVDGAKEL
• TKIPMFI
• IYHCDLTKEELEP
• NQRPDLF
• RGGGEYG
• GGSNGGLL
• GILKWVKLIDNFEGEYDY
• FKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARV
• QDYHGHK
• EIFYQFTSFLSPG
• TIGHAWTTDYGCSD
• AAEYLIKE
• YPQQDGKSDGTETSTNLHQKL
• YHGHKICDPY
• TGALLKTFPL
• YGGFNIS
• KYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHS
• VGVMDML
• See less «

 

b) ( PARALOG GENE Tässä paralogissa on useita cysteiinejä, rakenne on puoli propellimainen verattuna edelliseen ja se katsotaan solunsisäiseksi, osallistu retrogradisen suunnan liikutteluun. Endosomi Golgi, Golgi PM, ja lopulta Ja lopulta mm synaptisen vesikkelin erityksiin)

Aliases for PREPL Gene 2p21.

• GeneCards Symbol: PREPL ²

• Prolyl Endopeptidase Like ^{2 3 5}

• Prolyl Endopeptidase-Like ^{2 3 4}

• KIAA0436 ^{2 4 5}

• Putative Prolyl Oligopeptidase ³

• Prolylendopeptidase-Like ⁴

• EC 3.4.21.83 ⁴⁸

• EC 3.4.21.- ⁴

• EC 3.4.21 ⁴⁸

• CMS22 ³

Gene Families for PREPL Gene

IUPHAR :S9: Prolyl oligopeptidase

Human Protein Atlas (HPA):

• Disease related genes

• Enzymes

• Human disease related genes

• Potential drug targets

• Predicted intracellular proteins

Protein Domains for PREPL Gene

InterPro:

• AB_hydrolase

• Peptidase_S9

• Pept_S9A_N

• Peptidase_S9A

Blocks:

• Prolyl oligopeptidase serine protease (S9A) signature

Suggested Antigen Peptide Sequences for PREPL Gene

GenScript: Design optimal peptide antigens:

• Prolylendopeptidase-like (PPCEL_HUMAN)

  Graphical View of Domain Structure for InterPro EntryQ4J6C6 UniProtKB/Swiss-Prot:PPCEL_HUMAN :

• Belongs to the peptidase S9A family.

Molecular function for PREPL Gene according to UniProtKB/Swiss-Prot

Function:

• Serine peptidase whose precise substrate specificity remains unclear (PubMed:16143824, 16385448, 28726805).
  Does not cleave peptides after a arginine (R)  or lysine (K) residue (PubMed:16143824).
  Regulates trans-Golgi network morphology and sorting by regulating the membrane binding of the AP-1 complex (PubMed:23321636).
  May play a role in the regulation of synaptic vesicle exocytosis (PubMed:24610330). PPCEL_HUMAN,Q4J6C6

EnzymeRegulation:

• Inhibited by PMSF and Prefabloc, as well as leupeptin at high concentrations (PubMed:16385448).
  Partially inhibited by TPCK, a chymotrypsin inhibitor and E64, a cysteine protease inhibitor (PubMed:16385448).
  Not affected by 4-amidinophenyl-methanesulfonyl fluoride (APMSF), pepstatin or EDTA (PubMed:16385448).
  Inhibited by 1-isobutyl-3-oxo-3,5,6,7-tetrahydro-2H-cyclopenta[c]pyridine-4-carbonitrile (PubMed:28726805). PPCEL_HUMAN,Q4J6C6

Phenotypes for PREPL Gene MGI mutant phenotypes for PREPL:

inferred from 2 alleles

• nervous system phenotype

• vision/eye phenotype

• growth/size/body region phenotype

• behavior/neurological phenotype

• muscle phenotype

• skeleton phenotype

• mortality/aging

GenomeRNAi human phenotypes for PREPL:

• Increased vaccinia virus (VACV) infection

• no effect

• Decreased viability

• Increased shRNA abundance (Z-score > 2)

• Decreased HPV16-GFP infection

• Decreased shRNA abundance (Z-score < -2)

Gluteenin ruoansulatuspätkistä tulee paljon QP-rakenteisiä peptidejä. proly -glutamyl- prolyl ym oligopeptidejä

Uusi  Duodecim 2023 ; 139;841.kertoo  artikkelissa  Prolyylioligopeptidaasien estäjistä apua muistisairauksien  pysäyttämiseen?

 AJATUKSIANI 10.6. 2023.

 Jos on entsyymivajetta siinä vaiheesas, missä näitä proliinj-proliini, (PP)    proliiniglutamiini (PQ)ja glutamiiniglutamiini (QQ)  ja glutamiiniproliini (QP)  sidoskohtia ei pilkkoudukaan ja  jää  eräänlaisia  T-solujen havaitsemia   oligopeptidejä ja ne ovat  antigeenejä. 

 Neuronaalinen signalointi vaatii yksittäisten  glutamiinista (Q) muodostuvien glutamiinihappojen (E) tai  GABA  gamma-aminovoihappojen  hyvää mudostumista ja sykliä.  GLU on excitatorinen, GABA inhibitorine ja GLN  antaa  vapaata  sidosenergiaa kohdissa, missaä  ei ole mahdollista käyttää isoja ATP  tai  pienempiäkään rikastuneita inositoliperäisiä  fosfaatteja  energialähteinä.  Siis Q on se ilmainen energialähde, E on  stimuloiva ja GABA inhiboiva.   Tähän ydinmoduliin reseptorisettiensä kanssa  perustuu neuronien muistin lataustoiminta ja muistin esiinhakemistoiminta.

Haitallinen rakenne on Hungington-viruksessa, sillä siinä on näitä PPP ja QP jaksoja, joita  keho ei pysty kaikilla kai  pilkkomaan proteosomissa ja  immuunivasteessa.Jptkut  virusrakenteet vehnän tapaan  suosivat näitä aminohappoja.  https://www.mdpi.com/biomolecules/biomolecules-10-01458/article_deploy/html/images/biomolecules-10-01458-g001.png

  https://www.mdpi.com/biomolecules/biomolecules-10-01458/article_deploy/html/images/biomolecules-10-01458-g001.png

Nyt on hiirillä huomattu että  muistin latauksessa ja esiinotossa tärkeät  aivojen etuosat hiirillä voivat  olla  muistihäiriön ayntyalue ja  siten kun on  tällaisia haittapeptidejä  paljon siihen on keksitty entsyymin estäjä. ja hiirien muisti paranee.

 

 Varmaan hieno asia , mutta tuohon järjestelmään pitää asettaa  eliminaatiodieetti:jolloin  samaan  heikkoon aineenvaihdunnalliseen linkkiin  tulisi tukea  tiukasta ( gluteenittomasta  dieetistä, jolloin näitä  oligopeptidejä ei jäisi sulamatta  niin suunnattomia määriä kehoon, mikä säätää tuollaista sekundääristi entsyymiä ylös.  Se onkin  siten paradigma, joka vain pitäisi ottaa huomioon. 

Sen sijaan että keksitään  esim  desensitoimisteitä kuten  vähemmän gluteenisen ( aveniiniprolamiinityyppisen)  kauran  palauttamista   laajalti keliakiadieettiin, voisi  löytää sen entsyymin, josta  ytimissä on kysymys primääristi. ja siten voi esikäsitellä ne sidokset ja jos  se ei auta, tekijä on myös jokin toinenkin, lektiinitaso tms. 

Toistaiseksi  suosittelen englantilaista linja, jossa ei  palautteta  kauraa vielä, koska kerran ei tiedetä primääriä  entsyymivajetta.  

 

Uusi  Duodecim 2023 ; 139;841.kertoo  artikkelissa  Prolyylioligopeptidaasien estäjistä apua muistisairauksien  pysäyttämiseen?

JUOMAVESI Erityinen tieteellinen artikkeli (2020) eräästä vuoristoperäisestä terveysvedestä (LCMW) Espanjasta

 Tämä on sikäli erikoinen kuvaus, että siinä yksityiskohtaisesti(koeläimillä) esitetään  suolinukkapinnan muutosta tämän terveysvesikuurin aikutuksesta. Tosin tässä on koe-eläinten   ehjä perusnukka eikä  ihmisen keliakian  jo kaivertama ja latistama nukkaatrofinen (VA) tilanne :

1) Ainutlaatuisen terveysveden Lanjaro-Capucchino-Mineral waater- kuvaus espanjalaisessa tutkimuksessa, joka selvittää koe-eläintutkimusken avulla tmän erityisen mineraalipitoisen vuoristoveden vaikutusta suoliston erilaisiin funktionaalisiin häiriöihin. Tässä mineraalivedessä on

Order Article Reprints Open AccessArticle Effects of Sodium Chloride-Rich Mineral Water on Intestinal Epithelium. Experimental Study by Pascual-Vicente Crespo^1,†, Fernando Campos^1,†,Manuel Leal² and Francisco Maraver^2,3,*Tissue Engineering Group, Department of Histology, University of Granada, 18016 Granada, Spain² Professional School of Medical Hydrology, Complutense University of Madrid, Plaza Ramón y Cajal s/n, 28040 Madrid, Spain³ Medical Hydrology Group, Department of Radiology, Rehabilitation & Physiotherapy, Complutense University of Madrid, Plaza Ramón y Cajal s/n, 28040 Madrid, Spain^*Author to whom correspondence should be addressed. ^†

These authors contributed equally to this work. Int. J. Environ. Res. Public Health 2021, 18(6), 3261; https://doi.org/10.3390/ijerph18063261 Received: 29 December 2020 / Revised: 20 February 2021 / Accepted: 19 March 2021 / Published: 22 March 2021 (This article belongs to the Special Issue Health Resort Medicine: Resources and Applications in Environmental Health)

2) LCMW Mineraalipitoisen veden lähde Espanjassa:

Balneario de Lanjarón en Granada, Andalucía. Relais Termal, cadena líder de Balnearios de España

• Balneario de Lanjarón - en

• Thermal Spa

Thermal Spa

Six minero-medicinal springs
The prestige of Lanjarón as a thermal baths is down to the variety and quality of its waters.

Thermal baths

The fault of Lanjarón, forming the border between the unique landscapes of the Sierra Nevada and the Alpujarras explains the profusion of streams around the village. The different rocks of this area allow the rainwater fallen years ago in Sierra Nevada to be filtered back the surface for our benefits.

Some of these waters were in contact during years with minerals that is why they are so valuable because the very high concentration of minerals they have. Others springs come from the fusion of the perpetual snows and rains and hence exceptionally pure water with less minerals.

https://www.mdpi.com/1660-4601/18/6/3261

3) Minerallivesiterapioitten hyödyllistä osuudesta post-Covid oireisiin? Ainakin suomalaisen kannattaa katsoa minkäkaltaista vettä käyttää ne 366 päivää vuodessa. Ei ihme että ulkomaanmatkat Välimeren ilmastoon ovat piristeeksi ja hyvin suosittuja. Omasta mielestäni oli mahtavan keveä hengittää esim Israelin suolameren rannan ilmastossa tai Kinneretin rannoilla. Siellä mienraalipitoisuus on toista luokkaa myös verrattuna Suomen juomavesiin. Eipä ihme että suomalaiset virkistyvät niillä matkoilla. Toivotaan että sikäläinen kansa joka provinssisa huomaa maan turismiarvon ja osaa hyödyntää sitä rauhanomaisissa olosuhteissa omaksi edukseenkin.

https://pubmed.ncbi.nlm.nih.gov/35079866/

Raikas hedelmäjälkiruoka. Granaattiomenan mehua ja siementä jogurtissa

 Gramaattihedelmä on yksi niitä hedelmiä, joita ei tullut nähtyä eikä käytettyä Suoemssa nuoruuteni aikana. ensimmäinen kerta oli vuonna 1972 kun tutustuin granaattihedelmäpuun ulkonäköön:  Asuin kuukauden  lkähetystyöntekijä Rose Warmerin luona ja hänellä oli puutarha Karmelvuoren länsirinteellä. Hän istutti puutarhaansa  aikanaan useita hedelmäpuita ja sypressit reunustivat puutarhaa. Talonkin hän aikanaan oli itse pystyttänyt.   Olin siellä toukokuun aikaan ja granaattihedelmäpuussa oli kukkia.  Piirsin kuvan hedelmänraakileista ja kukista.  Rose halusi kuvan muistoksi itselleen ja annoin.

 Muta silloin vielä en ollut  syönyt granaattihedelmää. Niitä  olen ostanut  täällä Ruotsissa  silloin tällöin Ica-kaupasta tai torilta. Koska vaikutan perheessäni olevan ainoa joka pitää granaattiomenasta  ostan yhden hedelmän viikkoa kohti. Pidän sitä jääkaapissa ja siten kun otan käyttöön jaan sen kahtia. Toisen puolen säästän toiseen päivään.

 Otan pienen kulhon ja pursitan siemenet siihen, Avuksi käytän mm. riisipuikkoa tai haarukkaa että saan joka siemenen talteen ja varsinkin mehun. Jos sisäpinnan nahkaosia tulee mukaan  ei pieni määrä haitaa. niisäkin on terveellisiä ainesosia.

Sitten lisään  laktoositonta jugurttia annoksen ja sekoitan siement, jogurtin ja mehun. Siten  nautin  sen joko riisipuffeja tai gluteenitonta müsliä siihen sekoittaen  vähän riippuen siitä onko  enemmän kalorin tarve sillä hetekllä. 

Kun granaattihedelmä on jääkaappikylmä, se on   mehuisampia ja raikkaampi. Sen kuori on vahva, joten se säilyy hyvänä pitkän aikaa. 

 

Jogurtin sijasta voi käyttää myös  tofujäätelöä tai laktoositonta kermavaahtoa.  

Myös pelkkään maitoon sekoitetut granaattiomenansiemenet  muodostava  sakeutuneen  hienoaromisen jälkiruoan.  

11.3. 2023 Wikipediatieto granaattiomenasta:

Domeeni:	Aitotumaiset Eucarya
Kunta:	Kasvit Plantae
Alakunta:	Putkilokasvit Tracheobionta
Kaari:	Siemenkasvit Spermatophyta
Alakaari:	Koppisiemeniset Magnoliophytina
Luokka:	Kaksisirkkaiset Magnoliopsida
Lahko:	Myrtales
Heimo:	Rantakukkakasvit Lythraceae (Punicaceae)
Suku:	Granaattiomenat Punica
Laji:	granatum

Granaattiomena (Punica granatum) on rantakukkakasvien heimoon kuuluva lehtipuu, jonka hedelmät ovat syötäviä. Se on kotoisin Keski-Aasiasta ja sitä on viljelty Kaukasuksen ja Välimeren seuduilla tuhansien vuosien ajan. Kasvista käytetään myös nimeä karthagonomena. Sen hedelmä on useissa kulttuureissa ollut hedelmällisyyden symboli runsaan siemenmääränsä vuoksi.

Granaattiomena ei nimestään huolimatta ole kovin läheistä sukua omenoille, sillä ne kuuluvat eri heimoihin ja lahkoihinkin.

Ravintoarvoja per 100 g

	Granaattiomena[4]
Proteiineja	1,7 g
Rasvaa	1,2 g
Hiilihydraatteja	14,7 g
C-vitamiinia	10,2 mg
Kalsiumia	10,0 mg
Rautaa	0,3 mg
Kaliumia	264 mg
Magnesiumia	12,0 mg
Natriumia	3,0 mg
Fosforia	36,0 mg
Sinkkiä	0,3 mg

Granaattiomenasta käytetään sisus eli malto ja siemenet, sillä hedelmälihan väliseinät sisältävät pahanmakuista happoa. Hedelmän voi esimerkiksi puristaa mehuksi, se sopii muun muassa smoothieihin ja muihin juomiin. Punaiset siemenet puolestaan sopivat hyvin salaatteihin, rahkoihin ja koristeeksi esimerkiksi leivonnaisiin.^[5] Puun lehdistä ja kaikista kuoriosista saadaan myös runsaasti tanniineja, joita on käytetty nahan parkitsemisessa. Granaattiomenapuun kukista ja hedelmän kuoresta valmistetaan väriaineita ja kaarnasta hyönteismyrkkyjä.

Punaisena elintarvikeväriaineena käytettävä grenadiini tehdään granaattiomenasta.^[6]

Kuivatut granaattiomenan siemenet ovat hieman tahmeita ja väriltään mustia tai punaisia. Siemenet on murskattava huhmareessa, sillä ne ovat niin tahmeita, että jäävät kiinni tehosekoittimen terään. Murskattuja siemeniä sirotetaan joskus mausteeksi puuroon.^[7]

Granaattiomenan siemeniä käytettiin antiikin Kreikassa raskauksien ehkäisyyn ja keskeytykseen.^[8]

Granaattiomenan siementen rubiinimainen, syvänpunainen, väri on merkki niiden sisältämästä antioksidanttien suuresta määrästä. Antioksidantit ovat yhdisteitä, jotka estävät vapaiden radikaalien aiheuttamia soluvaurioita, antioksidanttipitoista ruokaa voidaankin pitää hyvänä ennaltaehkäisijänä moniin sairauksiin ja ainakin joihinkin ikääntymisen mukanaan tuomiin muutoksiin. Esimerkiksi granaattiomenamehun antioksidanttinen kapasiteetti on 2 860 yksikköä 100 grammaa kohti ja näin ollen se asettuu samaan kategoriaan luumumehun, goji-marjojen ja melonimehun kanssa. Lisäksi granaattiomena sisältää monia vitamiineja, kuten C, B₉, B₅ ja K, kivennäisaineita, kuten kaliumia ja sinkkiä sekä mikroravinteita.^[9]

 Sitaatti:https://web.archive.org/web/20130323001940/http://icebb.net/tag/granaattiomena-terveysvaikutukset/

"Granaattiomenat ja antioksidantit

Granaattioman syvän punainen väri on enemmän kuin vain vetovoimaa lautasella: granaattiomenan tummanpunainen väri merkitsee, että hedelmä on täynnä antioksidanttien fytokemikaaleja. Antioksidantit torjuvat vapaiden radikaalien aiheuttamia soluvaurioita. Kun tutkijat yhä tutkivat antioksidanttien vaikutuksia ihmiskehossa eivätkä ole vielä päätelleet, että nämä yhdisteet toimivat samoin ihmisillä ja koeputkitesteissä , Syöpäyhdistys väittää, että he ovat edenneet testauksessa niin pitkälle, että he voivat väittää, että antioksidantit auttavat ehkäisemään vapaiden radikaalien aiheuttamaa tuhoa, joka on yhdistetty syöpään. On mahdotonta puhua sairauksien hoidosta antioksidanttien avulla, mutta on selvää, että antioksidanttinen ruoka olisi järkevä ja ennaltaehkäisevä hoitomuoto.

Monessa ruoassa on antioksidantteja, mutta vain granaattiomenissa on joukko yhdisteitä, jota kutsutaan punicalagineiksi. Tällä sanahirviöllä on juuret
granaattiomenan tieteellisessä nimessä, Punica granatum. Punicalagineillä on sama kyky neutralisoida vapaat radikaalit kuten muitakin antioksidantteja, mutta alustavat tutkimukset osoittavat, että nämä aineet myös aktiivisesti etsivät vapaita radikaaleja ja niillä voi olla myös vaikutusta vähentää mahdollisuutta saada eturauhas-, keuhko- tai rintasyövän.

Granaattiomenamehussa on antioksidanttista kapasiteettia 2860 yksikköä 100 grammassa. Se on verrattavissa luumumehuun, gojimarjoihin ja melonimehuun.
Jos tutkimus osoittaa eron punicalagineiden ja muiden antioksidanttien välillä, molempien kulutus voisi olla jopa suurempi johtuen puskurivaikutuksesta
vapaisiin radikaaleihin.

 Punicalagines   HAKU:PubMed, yli 500 hakuvastausta.

https://pubmed.ncbi.nlm.nih.gov/?term=punicalagines+

Muutama esimerkki hiirikokeista:

 (1)

An X, Zhang Y, Cao Y, Chen J, Qin H, Yang L. Nutrients. 2020 May 22;12(5):1516. doi: 10.3390/nu12051516. PMID: 32456088 Free PMC article.

"Pyroptosis is an essential manner of programmed cell death in the inflammatory response; the expression of pyroptosis-related proteins such as interleukin-1 (IL-1β), cysteinyl aspartate-specific protease-1 (caspase-1), gasdermin D (GSDMD), and nucleotide-binding oligomerization domain, leucine-rich repeat and pyrin domain containing protein 3 (NLRP3) was decreased in our study, which proved that the administration of punicalagin for eight weeks can significantly inhibit pyroptosis in mice. In addition, punicalagin reduced high glucose-mediated protein expressions of nicotinamide adenine dinucleotide phosphate (NADPH) oxidase 4 (NOX4) and alleviated mitochondria damage. Low expression of NOX4 inhibits the dissociation of thioredoxin (Trx) and thioredoxin-interacting protein (TXNIP) and the suppression of NLRP3 inflammasome activation. To summarize, our study provided evidence that punicalagin can alleviate diabetic nephropathy, and the effect is associated with downregulating the expression of NOX4, inhibiting TXNIP/NLRP3 pathway-mediated pyroptosis, suggesting its therapeutic implications for complications of diabetes

 (2)

Jie Xu  ¹ , Ke Cao  ¹ , Xuyun Liu  ¹ , Lin Zhao  ¹ , Zhihui Feng  ² , Jiankang Liu  ^{1   3}

DOI: 10.3390/antiox11010029

The extracts of pomegranate fruit and peel have been reported to possess health-beneficial properties in inflammation-associated chronic diseases. Punicalagin is considered to be the major active component of pomegranate extracts. In this review we have focused on recent studies into the therapeutic effects of punicalagin on inflammation-associated chronic diseases and the regulatory roles in NF-κB, MAPK, IL-6/JAK/STAT3 and PI3K/Akt/mTOR signaling pathways. We have concluded that punicalagin may be a promising therapeutic compound in preventing and treating inflammation-associated chronic diseases, although further clinical studies are required.

 (3)

Eva Venusova  ¹ , Adriana Kolesarova  ² 

DOI: 10.3390/nu13072150

Punicalagin (PUN) is an ellagitannin found in the peel of pomegranate (Punica granatum). It is a polyphenol with proven antioxidant....

 (4)

Anti-inflammatory potential of ellagic acid, gallic acid and punicalagin A and B isolated from Punica granatum

Lamees A BenSaad  ¹ , Kah Hwi Kim  ² 

AffiliationsDOI: 10.1186/s12906-017-1555-0 

 

Muistiin  11.3. 2023